PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P21480_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 144aa    MW: 16385.8 Da    PI: 8.5046
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P21480_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.99.7e-271059251
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            rien   rq tfskRrng+ KKA ELSvLCdaeva+iifss+gkl+++ss
  GSMUA_Achr11P21480_001 10 RIENAASRQATFSKRRNGLAKKALELSVLCDAEVALIIFSSQGKLHDFSS 59
                            9***********************************************96 PP

2K-box42.72.3e-1581142970
                   K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                               e++ e+l++e a + k++e L+ ++ +llG++Les+s++eL++Le q+e++l+ iR +K 
  GSMUA_Achr11P21480_001  81 SMEHDIEELKHEEACMSKKMELLEASKQKLLGKNLESCSFEELHELEGQIEQGLRDIRVRKA 142
                             5678899*****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.217161IPR002100Transcription factor, MADS-box
SMARTSM004328.0E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-30389IPR002100Transcription factor, MADS-box
CDDcd002651.84E-34378No hitNo description
PRINTSPR004046.8E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-263859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-1583142IPR002487Transcription factor, K-box
PROSITE profilePS512979.47986144IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MVKGKRVIQR IENAASRQAT FSKRRNGLAK KALELSVLCD AEVALIIFSS QGKLHDFSSS  60
SVLETIKRYR AHSREDTISI SMEHDIEELK HEEACMSKKM ELLEASKQKL LGKNLESCSF  120
EELHELEGQI EQGLRDIRVR KASQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-16872771Myocyte-specific enhancer factor 2A
3mu6_B2e-16872771Myocyte-specific enhancer factor 2A
3mu6_C2e-16872771Myocyte-specific enhancer factor 2A
3mu6_D2e-16872771Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384513.12e-95PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ604e-51MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RU783e-99M0RU78_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P21480_0018e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-51AGAMOUS-like 20